Protein Info for ABIE41_RS21640 in Bosea sp. OAE506

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 70 to 91 (22 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 198 to 223 (26 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 87 to 274 (188 residues), 61.1 bits, see alignment E=6.1e-21

Best Hits

KEGG orthology group: K11075, putrescine transport system permease protein (inferred from 64% identity to avi:Avi_0823)

Predicted SEED Role

"Putrescine transport system permease protein PotH (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>ABIE41_RS21640 ABC transporter permease subunit (Bosea sp. OAE506)
MAVPYLWLGLFFLAPFVMVLRIALSDAATALPPYAPHFEGFAALRDFLAGLDLENFGLIL
EDPLYWQSYLYSLRIAALTTLIALAIGYPLAYAMASAPARWRAILLVLVILPFWTSFLIR
VYAWIGILRPEGLLDMALAALGLSDQPLRLLNTEAAVLIGMVYSYMPFMVLPLYATLEKL
DRSLLEAAADLGATPLRAFLTVTLPLSLSGILAGSALVFIPAIGEFVIPDLLGGPDTTMI
GKVLWTEFFSNRDWPLASAVAVVLLVVLVLPLALLQRARLARAGEAGGAA