Protein Info for ABIE41_RS21120 in Bosea sp. OAE506

Annotation: GTP 3',8-cyclase MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 41 to 369 (329 residues), 358.8 bits, see alignment E=1.2e-111 PF04055: Radical_SAM" amino acids 54 to 215 (162 residues), 133.3 bits, see alignment E=1.5e-42 PF13353: Fer4_12" amino acids 59 to 162 (104 residues), 29.6 bits, see alignment E=1.2e-10 PF06463: Mob_synth_C" amino acids 222 to 348 (127 residues), 129.1 bits, see alignment E=1.5e-41

Best Hits

Swiss-Prot: 78% identical to MOAA_RHOPS: GTP 3',8-cyclase (moaA) from Rhodopseudomonas palustris (strain BisB5)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 78% identity to rpd:RPD_2052)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>ABIE41_RS21120 GTP 3',8-cyclase MoaA (Bosea sp. OAE506)
MGLSLPQTRPPNGQLPIVLLDSPLPDAAARPGIAPLARPVLTDPFGRDISYLRISVTDRC
DFRCVYCMSEDMTFLPKRDLLTLEEIDRLATAFIARGTRKLRLTGGEPLVRRDVMSLFRS
LSRHLTSGALEELTLTTNGSLLDRYAQEMADYGVRRINVSLDTLDPDKFRQITRWGDLDK
VLGGIEAARKAGMRVKINAVALKGVNEDEIESLMVWAHGLGMDLTLIEVMPLGEIEPGRI
DQFLPLSVVRARLMDKYNLVEDPYRTGGPARYVRVQETGGLVGFITPMTHNFCESCNRVR
LTCTGTLYMCLGQEDAADLRAPLRASADDALLHRAMEEAIARKPKGHDFVIDRRRAKPAV
GRHMSVTGG