Protein Info for ABIE41_RS21035 in Bosea sp. OAE506

Annotation: cytochrome o ubiquinol oxidase subunit IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details TIGR02847: cytochrome o ubiquinol oxidase subunit IV" amino acids 22 to 118 (97 residues), 106.4 bits, see alignment E=4.3e-35 PF03626: COX4_pro" amino acids 30 to 102 (73 residues), 61.4 bits, see alignment E=4.3e-21

Best Hits

Swiss-Prot: 42% identical to CYOD_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 4 (cyoD) from Pseudomonas putida

KEGG orthology group: K02300, cytochrome o ubiquinol oxidase operon protein cyoD (inferred from 79% identity to azc:AZC_2101)

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (127 amino acids)

>ABIE41_RS21035 cytochrome o ubiquinol oxidase subunit IV (Bosea sp. OAE506)
MSSETNAQHQPGYEPHPEDEAHGSFRGYMTGFGLSVVLTAIPFWLVMSGALGNNQLTGFV
VMGFAVVQIVVHMIYFLHMNGRVEGGWTLLALVFTVIVVVITLAGSLWVMYHLNTNMMPV
HDMRQMP