Protein Info for ABIE41_RS20830 in Bosea sp. OAE506

Annotation: phosphatidylserine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 55 to 70 (16 residues), see Phobius details amino acids 76 to 92 (17 residues), see Phobius details TIGR00164: phosphatidylserine decarboxylase homolog" amino acids 52 to 257 (206 residues), 195.2 bits, see alignment E=4.2e-62 PF02666: PS_Dcarbxylase" amino acids 85 to 254 (170 residues), 151.5 bits, see alignment E=1.2e-48

Best Hits

Swiss-Prot: 65% identical to PSD_BRADU: Phosphatidylserine decarboxylase proenzyme (psd) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 65% identity to rpx:Rpdx1_3503)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>ABIE41_RS20830 phosphatidylserine decarboxylase (Bosea sp. OAE506)
MRAPNPLNSAQNRRPFPPQTASGGATAARSASRNSKPMSLVDSVRKVIVPIHKEGYVFIA
IALVATIVLANLWSPFGWIGAIITLWICYFFRDPIRITPQREGLVISPADGRVSQVASAL
PPPELNLPAEPMTRISIFMNVFDCHVNRAPVPGRIVKMAYTPGLFLNAELDKASDDNERN
ALAIETAHGIVGVVQIAGLIARRIVPFVKEGEVIGTGERFGLIRFGSRVDVYLPLGVVPL
VGEGQTAFAGETVLADFAGSEPAVRAFRGI