Protein Info for ABIE41_RS20830 in Bosea sp. OAE506

Annotation: phosphatidylserine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00164: phosphatidylserine decarboxylase homolog
  • amino acids 52 to 257 (206 residues), 195.2 bits, E=4.2e-62
• PF02666: PS_Dcarbxylase
  • amino acids 85 to 254 (170 residues), 151.5 bits, E=1.2e-48

Best Hits

Swiss-Prot: 65% identical to PSD_BRADU: Phosphatidylserine decarboxylase proenzyme (psd) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 65% identity to rpx:Rpdx1_3503)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (9/12 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (8/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (11/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Protein Sequence (270 amino acids)

>ABIE41_RS20830 phosphatidylserine decarboxylase (Bosea sp. OAE506)
MRAPNPLNSAQNRRPFPPQTASGGATAARSASRNSKPMSLVDSVRKVIVPIHKEGYVFIA
IALVATIVLANLWSPFGWIGAIITLWICYFFRDPIRITPQREGLVISPADGRVSQVASAL
PPPELNLPAEPMTRISIFMNVFDCHVNRAPVPGRIVKMAYTPGLFLNAELDKASDDNERN
ALAIETAHGIVGVVQIAGLIARRIVPFVKEGEVIGTGERFGLIRFGSRVDVYLPLGVVPL
VGEGQTAFAGETVLADFAGSEPAVRAFRGI