Protein Info for ABIE41_RS20770 in Bosea sp. OAE506

Annotation: ribulose-bisphosphate carboxylase large subunit family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02788: RuBisCO_large_N
  • amino acids 16 to 128 (113 residues), 31.5 bits, E=1.8e-11
• PF00016: RuBisCO_large
  • amino acids 138 to 416 (279 residues), 259 bits, E=5.4e-81

Best Hits

Swiss-Prot: 61% identical to OIAT_XANP2: 3-oxo-isoapionate-4-phosphate transcarboxylase/hydrolase (oiaT) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K01601, ribulose-bisphosphate carboxylase large chain [EC: 4.1.1.39] (inferred from 77% identity to mno:Mnod_3435)

MetaCyc: 61% identical to 3-oxoisoapionate-4-phosphate transcarboxylase/hydrolase (Xanthobacter autotrophicus Py2)
RXN-20936 [EC: 3.7.1.28]

Predicted SEED Role

No annotation

MetaCyc Pathways

• D-apionate degradation III (RLP transcarboxylase/hydrolase) (3/3 steps found)
• Rubisco shunt (8/10 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• oxygenic photosynthesis (11/17 steps found)
• nucleoside and nucleotide degradation (archaea) (4/10 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.28 or 4.1.1.39

Protein Sequence (419 amino acids)

>ABIE41_RS20770 ribulose-bisphosphate carboxylase large subunit family protein (Bosea sp. OAE506)
MLTDRFEADYLLETPIDPARAAETMAGEQSSGTFVAIPGETPELKERASARVVALEILER
DVPGRSLPSNVPSPPDERITRARVTLSWPLATIGPSLPNLVATVAGNLFELKCASGLRIL
DIRLPAAFGEAYPGPRFGVAGTRRLAGVEGRPLIGTIIKPSVGLDPAATAALVDELCGAG
IDFIKDDELQSDGPACPFDQRVAAVMAVVERHADRTGRKPMFAFNLTGDLDQMRRRHDTL
LAHGATCLMASLNSVGLVGMIELGRFAQLPIHAHRNGWGYLSRHPMLGWSYVAWQKLWRL
AGADHMHVNGLSNKFSETDDSVVASARECLTPMFADKPCTVMPVFSSGQTARQAHGTYAA
LGSTDLIMTAGGGVMAHPDGVAAGVRSLREAWAAAIAGIPLAEHARTHPELGRALEIAA