Protein Info for ABIE41_RS20740 in Bosea sp. OAE506

Annotation: NADH-quinone oxidoreductase subunit L

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 62 (25 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 167 to 193 (27 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 305 to 331 (27 residues), see Phobius details amino acids 361 to 386 (26 residues), see Phobius details amino acids 392 to 412 (21 residues), see Phobius details amino acids 419 to 437 (19 residues), see Phobius details amino acids 457 to 480 (24 residues), see Phobius details PF00662: Proton_antipo_N" amino acids 72 to 111 (40 residues), 35.8 bits, see alignment 5.9e-13 PF00361: Proton_antipo_M" amino acids 128 to 348 (221 residues), 142.6 bits, see alignment E=1.6e-45

Best Hits

KEGG orthology group: K05577, NADH dehydrogenase I subunit 5 [EC: 1.6.5.3] (inferred from 68% identity to met:M446_5663)

Predicted SEED Role

"NADH dehydrogenase, subunit 5" in subsystem Respiratory Complex I

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (528 amino acids)

>ABIE41_RS20740 NADH-quinone oxidoreductase subunit L (Bosea sp. OAE506)
MPHLALPLLAPAILAATALFLLRREALSAKGQGLLAEIAAALALVVALVAAVQLAVSGPA
TLTLLAPRGLGLSARLDIVGVTMLLLITFVGWVVLRFSRSYLTGEPGQRRFTGWICATLA
AAILLVCAGNLLQLLAAWIATSLCLHRLLLFYPARPAAQRAARKKFVVARLADTALLLAC
LVLFAGYGTGDIGAIMAQARSGPVPAGTGWAVALLVTAALLKSAQFPAHGWLVEVMEAPT
PVSALLHAGIINAGGFLLIRFADLLLTTPGALAALVLIGGFTALLGGLVMLTQSAIKTSL
AWSTVAQMGFMVLQCGLALFPLALLHIVAHSLYKAHAFLSSGWAVEQVAATRRPGPVAVA
SIRVVAQAFAFALALYALLGLGFGFADKSPQAIALGAILVFGVAYLIAQGLADAAPRALT
LRTSAAAIAASLSYFLLQRFAQWLTSATLPPIPPPTALEWALIVLTLLSFGGVAFAQALF
PHWAGHPALAGLRVHLANGFYGNAIFDRLTGGWAQPRPSLPTSERSPS