Protein Info for ABIE41_RS20065 in Bosea sp. OAE506

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 37 to 59 (23 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 124 to 141 (18 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details amino acids 275 to 292 (18 residues), see Phobius details PF00892: EamA" amino acids 13 to 141 (129 residues), 60.5 bits, see alignment E=1.1e-20 amino acids 164 to 292 (129 residues), 42.4 bits, see alignment E=4.4e-15

Best Hits

KEGG orthology group: None (inferred from 47% identity to smd:Smed_4483)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>ABIE41_RS20065 DMT family transporter (Bosea sp. OAE506)
MLSSPLFLRIVPLVFTFLWSSGWIVAGYSAQYADPLTFLAVRFATAGVLLAALSLAVGAP
WPATPRAWLDCAISGVLLHAIYLCGVWWAVRHGLPAGISGLIAGLQPILTALLAPALVGE
RISLIRWAGIAFGFVGIALVLEPKLVGVDPAALWGILIPVAVNIVGMVAVTFGSFFQKAR
IVSGDLRTVTTIQYAAAVVFTLPLAFALEPMRIEWNLTMALVLGWSVLALSLGGIGLYLL
ILRRGEVSRIATFLYLVPALVAVEAWILFGETLTPIQIAGMALTIIGVALASRK