Protein Info for ABIE41_RS19240 in Bosea sp. OAE506

Annotation: enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF00378: ECH_1" amino acids 18 to 270 (253 residues), 173.9 bits, see alignment E=3.9e-55 PF16113: ECH_2" amino acids 22 to 200 (179 residues), 90.6 bits, see alignment E=1.5e-29

Best Hits

Swiss-Prot: 47% identical to ECHD3_RAT: Enoyl-CoA hydratase domain-containing protein 3, mitochondrial (Echdc3) from Rattus norvegicus

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 69% identity to xau:Xaut_4341)

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>ABIE41_RS19240 enoyl-CoA hydratase (Bosea sp. OAE506)
MNAHARPEAAPALRREDHDGIAVLTLNRPQSRNPLSEAMLAALAESFTAIAADRSVKAVV
LAAEGPVFCAGHDLKEMSAHRADPDRGRAYFTDILGRCSRVMQQITALPQPVIAAVEGTA
TAAGCQLVASCDLAVAGEAARFCTPGVHIGLFCSTPMVALTRNLSAKHAMEMLLLGEMVP
ADEAARMGLVNRVVVAGSALAEAQRLAAVIASKSSATIRIGKRAFYEQREMGLAAAYDHA
SAVMVENMLARDAEEGIGAFVGKRAPVWKG