Protein Info for ABIE41_RS18215 in Bosea sp. OAE506

Annotation: HIT domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11969: DcpS_C
  • amino acids 9 to 108 (100 residues), 48.6 bits, E=1.1e-16
• PF01230: HIT
  • amino acids 15 to 111 (97 residues), 98.5 bits, E=3e-32

Best Hits

Swiss-Prot: 42% identical to YHI2_MYCTO: Uncharacterized HIT-like protein MT1300 (MT1300) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K02503, Hit-like protein involved in cell-cycle regulation (inferred from 68% identity to smk:Sinme_1293)

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)" (EC 3.6.1.17)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.17

Protein Sequence (142 amino acids)

>ABIE41_RS18215 HIT domain-containing protein (Bosea sp. OAE506)
MSAYDTDNVFARILRGELPSHTVYEDEATVAIMDIMPRADGHVLVLPKVACRNVLDAPPE
ALQAVALTTQRLARAVKAAFAADGVTIQQFNEAAGGQVVFHLHVHVIPRHDGVAMRPHTG
AMADADVLKANAEKIRSALTAF