Protein Info for ABIE41_RS17830 in Bosea sp. OAE506

Annotation: tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR00113: S-adenosylmethionine:tRNA ribosyltransferase-isomerase" amino acids 1 to 356 (356 residues), 382.7 bits, see alignment E=7.2e-119 PF02547: Queuosine_synth" amino acids 6 to 357 (352 residues), 413.7 bits, see alignment E=2.7e-128

Best Hits

Swiss-Prot: 68% identical to QUEA_METEP: S-adenosylmethionine:tRNA ribosyltransferase-isomerase (queA) from Methylobacterium extorquens (strain PA1)

KEGG orthology group: K07568, S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC: 5.-.-.-] (inferred from 69% identity to mno:Mnod_2656)

Predicted SEED Role

"S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC 5.-.-.-)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.-.-.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>ABIE41_RS17830 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA (Bosea sp. OAE506)
MDVGLFDFDLPEDRIALRPASPRDAARLLVVRPDAPQPFEDRGIRDLVDLLQPGDALVLN
DTRVIPSRLYGRRRRGEASARIEIMLHKREAADRWRAFARPAKKLALGETVTFGDEAENS
ACELGRLQAEIVAKAEGGEVELRFALAGPHLDEAIARLGELPLPPYIAGKRATDAADAQD
YQTMHASKDGAVAAPTAGLHFTPELVAALEARGVTRHLVTLHVGAGTFLPVKAEDTQDHR
MHAEWGTIAPETAASLNAVRARGGRIIAVGTTSLRLLESATGEDGVIQPFSGDTAIFITP
GYRFRAVDLLLTNFHLPRSTLFMLVSAFCGLDVMKRAYAHAIAENYRFYSYGDGSLLHRA
SEPSS