Protein Info for ABIE41_RS15590 in Bosea sp. OAE506

Annotation: molybdenum ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 335 to 352 (18 residues), see Phobius details TIGR02142: molybdate ABC transporter, ATP-binding protein" amino acids 3 to 355 (353 residues), 406 bits, see alignment E=7.5e-126 PF00005: ABC_tran" amino acids 19 to 158 (140 residues), 109 bits, see alignment E=3.1e-35 PF03459: TOBE" amino acids 292 to 355 (64 residues), 45.8 bits, see alignment E=5.9e-16

Best Hits

Swiss-Prot: 56% identical to MODC_RHILO: Molybdenum import ATP-binding protein ModC (modC) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 58% identity to met:M446_2541)

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>ABIE41_RS15590 molybdenum ABC transporter ATP-binding protein (Bosea sp. OAE506)
MVVRHRLGAFTLDATLRSQGGLTALYGPSGSGKTSLVNVIAGLIRPESGHVRLDGEALFD
RAGGVFVPPHRRRIGYVFQEARLFPHLSVRRNLLFGRWFAPRGGAERIDLPAVLDLLGIG
HLLARRPGDLSGGERQRVAIGRALLARPRLLLMDEPLASLDEARKAEILPYIERLRDEAG
IPIVYVSHALAEVARLATTVAIVEAGMVTACGPAATTLSRLDLALRPGSAEPGSLIEGTV
GARDPGFGLTRIETRAGMLEVVRTGLPAGETIRIRILASDVMIALAPVAGISALNQLHGT
VAEIGAAGGPDASTVDLRIDCGGERLAARLTRKSLVTMGLGIGSPVVAIVKSVSVETP