Protein Info for ABIE41_RS14835 in Bosea sp. OAE506

Annotation: bifunctional diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 655 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 53 to 70 (18 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 227 to 378 (152 residues), 117.7 bits, see alignment E=2.1e-38 PF00990: GGDEF" amino acids 231 to 378 (148 residues), 119.1 bits, see alignment E=1.7e-38 PF00563: EAL" amino acids 402 to 634 (233 residues), 229.1 bits, see alignment E=5.3e-72

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (655 amino acids)

>ABIE41_RS14835 bifunctional diguanylate cyclase/phosphodiesterase (Bosea sp. OAE506)
MITHPTAPLRQSGQVAAALLPIVRRNYLPALLVNYVASTAVSGLAATAGATWVWWWFGFV
TLVSLLRIAVQRAIVAAVTRGAAISPAREILIAGLGKLAAAASWAVLAWLLLGVADPLVK
FATSIVLAGMAAGAIGILSPFGVIGPLYIAILMVPGAIRLMLTSGPDSVIGLLGLVFCCV
MIAGHRANRILLLQSVQLGQRNTELMAEILDANQTLENKVRERTETLEHQASHDLLTGLL
NRRGLSEQFEKVVARAGTAEVYFLDLNRFKRINDTLGHDAGDYVLREIALRLMTRLPAQA
LIARWGGDELVVVTPGSAQAEASATVLEKLFSTPYVFYGQTLDVGASVGVACYPQDGQGL
EELIWAADLAATQAKRQNSAVPLSYDHSLAIALQRRERIADDIAAGLKQDQFWLAFQPIV
AAATGDLHGFEALLRWTHPTLGTLAPDEFIPIAEESNQIAMVGAWVLDRACAAAARWQRG
GVRAAVAVNCSVRQLAQPEFVDIVRGALARHQLGAQWLHLEVTESVFMPADDEQTLAVLT
QLDALGICLAVDDFGTGYSSLARLRDFPMRQIKIDKSFIADIDGRSRSVIEGAALIARRF
ALQIVAEGVETEAQATALLSLGIDSFQGYLVGRPVAQPQTAVNCPWLGANAAVAG