Protein Info for ABIE41_RS12595 in Bosea sp. OAE506

Annotation: PatB family C-S lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 TIGR04350: putative C-S lyase" amino acids 7 to 390 (384 residues), 389.4 bits, see alignment E=8.5e-121 PF00155: Aminotran_1_2" amino acids 64 to 386 (323 residues), 136.3 bits, see alignment E=7.8e-44

Best Hits

KEGG orthology group: K14155, cystathione beta-lyase [EC: 4.4.1.8] (inferred from 72% identity to rsq:Rsph17025_0147)

Predicted SEED Role

"Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.8

Use Curated BLAST to search for 4.4.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>ABIE41_RS12595 PatB family C-S lyase (Bosea sp. OAE506)
MSSAPNFDERIDRRGTHSSKWDMMEPIYGVPASDGIAMWVADMDFRPPSCVQGALEGMAS
HGLYGYFGDTKANHDSIRWWMQTRHGWEVELASIFTVNGLVNGTALCVAAYTKPGDGVVL
MTPVYHAFARVISAAGRQVVECPLAIENDRYVLDIAGWDAMMTGKERMLMLCSPHNPGGR
VWTREELRAIADFCVRHDLILVSDEIHHDLVMPGHKHQVMALAAPEIMDRLVMMTATTKT
FNIAGCHVGNIIVPDKALRAPLAAAINAAGVSPNSFGMMMATAAYSPEGAEWVDALVAYL
DGNRRLFEEGVSAIPGVRALPLEATYLAWIDFAGTGMATPEFTARVEKQARIAANHGPSF
GKGGASFLRFNLATPRASVAEAVERLQRAFGDLQ