Protein Info for ABIE41_RS12320 in Bosea sp. OAE506

Annotation: glutathione peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00255: GSHPx" amino acids 40 to 138 (99 residues), 80.4 bits, see alignment E=3.7e-27

Best Hits

Swiss-Prot: 30% identical to GPX4_ARATH: Probable glutathione peroxidase 4 (GPX4) from Arabidopsis thaliana

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 55% identity to mno:Mnod_1782)

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (189 amino acids)

>ABIE41_RS12320 glutathione peroxidase (Bosea sp. OAE506)
MTLRRREVLGWLAGACALPAAAGGAAAQAVSSASSLSFAKAGGGRMSLADYRGRPVLIVN
TATNCGFAGQFASLEQLWQRYRSRGLMLIAVPSNDFGGQEPLEGAAIAEAARQAHGATYA
FAEKTAVKGPEAHPFYRWAAAQRPTETPRWNFHKYLVGRSGELLGGYSSITDPIGPQLVR
AIGQELQAG