Protein Info for ABIE41_RS11720 in Bosea sp. OAE506

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 43 to 66 (24 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 112 to 136 (25 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 188 to 205 (18 residues), see Phobius details PF01810: LysE" amino acids 15 to 200 (186 residues), 116.4 bits, see alignment E=5.8e-38

Best Hits

KEGG orthology group: None (inferred from 80% identity to mci:Mesci_0413)

Predicted SEED Role

"FIG00792604: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>ABIE41_RS11720 LysE family translocator (Bosea sp. OAE506)
MTFETWAAFAAATAVLLVIPGPTILLVVSYALGQGWRTALPTAAGVALGDFTAMTLSMLG
VGALLATSATVFTALKWAGAAYLVWLGIKLFRAGGTLDAKPREDAVSSLKMLGHAWLVTA
LNPKSITFFVAFLPQFLDPKADFWTQMLIFEATFVTLAAANAFGYALIASRARAVVSSPR
AIRAINRTGGTLLIGAGIATLAMRTGTR