Protein Info for ABIE41_RS07870 in Bosea sp. OAE506

Annotation: tyrosine recombinase XerC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF02899: Phage_int_SAM_1" amino acids 10 to 94 (85 residues), 60.5 bits, see alignment E=1.6e-20 PF00589: Phage_integrase" amino acids 144 to 292 (149 residues), 109.1 bits, see alignment E=2.1e-35

Best Hits

Swiss-Prot: 64% identical to XERC_METNO: Tyrosine recombinase XerC (xerC) from Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 67% identity to bid:Bind_3124)

Predicted SEED Role

"Tyrosine recombinase XerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>ABIE41_RS07870 tyrosine recombinase XerC (Bosea sp. OAE506)
MTDFDTLARAWLDHLAHERRLSPKTLEAYSRDLRQFAAFLTEHLGGAPSVADIAALKPAD
LRAFLGRRRREEVGNRTLMRQLAALRSFARFGERTGRLTAAAFAATRGPRIGKALPRPLE
ARAARAVTRAETRTGDVRDPWILARDAAVLSLLYGCGLRISEALSLARAQAPASAGDTLT
VIGKGSKTRMVPVLPVVVDTIAAYLALCPWPLPPEGPLFVGAKGGPLSPRIIQLVVENLR
GALGLPDSATPHALRHSFATHLLGRGGDLRAIQELLGHASLSTTQIYTRVDSARLMAAYD
AAHPQAGR