Protein Info for ABIE41_RS07770 in Bosea sp. OAE506

Annotation: tripartite tricarboxylate transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 107 to 133 (27 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 314 to 336 (23 residues), see Phobius details amino acids 356 to 378 (23 residues), see Phobius details amino acids 391 to 422 (32 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details amino acids 468 to 489 (22 residues), see Phobius details PF01970: TctA" amino acids 18 to 438 (421 residues), 425.9 bits, see alignment E=7.2e-132

Best Hits

KEGG orthology group: None (inferred from 76% identity to bja:bll3049)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (501 amino acids)

>ABIE41_RS07770 tripartite tricarboxylate transporter permease (Bosea sp. OAE506)
MTNTIIQAFGLVFAPDVLIAIFASAIYGLVVGSLPGLSATMATALLVPVTFYLSPIAAVA
TIITASAMAIFSGDIPGCLLRIPGTPASAAYTDEAYAMTRKGQAETALGICLWFSALGGI
AGTLSLMVLAPVLAEFALSFSTYENFWLAMLGLMCATLVARSSPIKAIASMLLGLLITCV
GIDNPGGVARFTLGSTDLLGGIEVIPALVGVFALAEVMRALTEREPPKLEHRQLGGILKG
QWELTKKYPKQQARGNIVGIIIGVLPGAGADMAAWVSYAMAKRFSKTPEKFGTGHPEGLI
EAGASNNASLASGWVPALLFGIPGDTITAIAIGVLYMKGLNPGPTLFTEQASSMYALYII
FILGNIIMIPLGIIMIRLASRVVGAPRSAVMPIIMVFCAVGAFATAGNNLFAVYCVAAFG
LIGFVMEKNGYPVAAMVLGVVMGTMVEQNFVTSLIKSDGSLLPFFSRPVASVLAAMTFAA
LLWPVFSWATDKLRERRVAAA