Protein Info for ABIE41_RS07175 in Bosea sp. OAE506

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 PF00005: ABC_tran" amino acids 19 to 161 (143 residues), 125.2 bits, see alignment E=4.5e-40 PF08402: TOBE_2" amino acids 271 to 347 (77 residues), 48.4 bits, see alignment E=1.3e-16

Best Hits

Swiss-Prot: 52% identical to Y2787_BRUAB: Putative ATP-binding protein BruAb2_0487 (BruAb2_0487) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 64% identity to met:M446_4680)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>ABIE41_RS07175 ABC transporter ATP-binding protein (Bosea sp. OAE506)
MARLSIENLRKTYGDLTVVNNVDIDIADGEFLVLLGPSGCGKTTTLRMVAGFIAPSAGKI
AIGERDVTALPPWKRNCGLVFQSYALFPHMTVAENVAFGLEMRKISPADRAPRVAEALRL
VQLAGFDERYPRQLSGGQQQRVALARALAMEPDVLLLDEPLSNLDAKLRQEVRVEIRDLQ
RKLGLTTIMVTHDQEEALTMADRLVVMEKGEVRQIGTQRELYERPADRFVAGFIGRSAFL
DGDIVAPGRFQTRGGVAIGCAAATGTGAATLALRPERIAVGGEAQGLHNRFEARVEHASY
LGAILEIDVSLSGTDRMLLQIPNKAGVAEPKPGETIMIGWAEDAGLVYPREA