Protein Info for ABIE41_RS06675 in Bosea sp. OAE506

Annotation: TRAP transporter large permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 71 (25 residues), see Phobius details amino acids 84 to 124 (41 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 242 to 258 (17 residues), see Phobius details amino acids 273 to 295 (23 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details amino acids 378 to 380 (3 residues), see Phobius details amino acids 399 to 425 (27 residues), see Phobius details PF06808: DctM" amino acids 8 to 417 (410 residues), 352.4 bits, see alignment E=1.7e-109 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 421 (405 residues), 371.6 bits, see alignment E=2.2e-115

Best Hits

KEGG orthology group: None (inferred from 38% identity to cro:ROD_43511)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>ABIE41_RS06675 TRAP transporter large permease (Bosea sp. OAE506)
MVLAVICAIFFALALLGMPLVWALLLTTISTIWIFGQGYPLEAIFLSYLSSVEPLHLAAI
PLFIFTGELITHGGVGKRLIDFARSLLAFMPGGLGVVTVSACTMFGSVSGSAVADSAAIG
SIMVPRMAERGYPRAFAGALIAVAGTIGVLMPLSIPLLVYGFVGNVSIRELLVSGVFPAF
TLAFALILLCIWKGRSLGCDLGGAMPSRAEIWKSFVAILPASGMPVVILGGILSGVFTPT
EAASVAVFYGLVLALFVYREVKPRQVPEMLLHSFRTSAVVMLVVGATGALSWLITVEQIP
ANLAQAILAVSENKYVFLLLLNIALILVGIFLEPLPSLMLTAPLFIPTAKAFGIDPVHLG
LIMVFNLVIGLYTPPVGGTLFVAAKIARVGMVAISRELIPMFAIALVVLFTVTYVEAIPM
ALVWFMRG