Protein Info for ABIE41_RS06100 in Bosea sp. OAE506

Annotation: site-specific tyrosine recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF02899: Phage_int_SAM_1" amino acids 11 to 89 (79 residues), 77.6 bits, see alignment E=1.1e-25 PF13495: Phage_int_SAM_4" amino acids 18 to 83 (66 residues), 27.6 bits, see alignment E=4.6e-10 PF00589: Phage_integrase" amino acids 115 to 292 (178 residues), 143.5 bits, see alignment E=8.9e-46

Best Hits

Swiss-Prot: 60% identical to XERD_BRADU: Tyrosine recombinase XerD (xerD) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 66% identity to mdi:METDI3240)

Predicted SEED Role

"Tyrosine recombinase XerD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>ABIE41_RS06100 site-specific tyrosine recombinase XerD (Bosea sp. OAE506)
MSRIAQARRNGFLDMLAAERGAARNTLDAYQRDIDDYLEFLGGRVLEAATADDIRGWLAD
LSERGLKASSAARRLSAVRQFHRFLYTEGFASNDPTAAIQGPRLGRPLPKVISVADVERL
IATAREACTREGLTPVARLRALRMRCLIEMLYATGLRVSELIALPLSAATTRERFLVVRG
KGNKDRLVPLNEPAREAAKLWLAALRESGAAEGRLLFPAEGESGHLTRQAFGRDLKALGG
AAGLSGAALSPHVLRHAFASHLLQNGADLRVVQELLGHSDIATTQIYTHVLDDRLKSLVR
DLHPLADEA