Protein Info for ABIE41_RS02350 in Bosea sp. OAE506

Annotation: arginase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00491: Arginase
  • amino acids 5 to 297 (293 residues), 235 bits, E=6.1e-74
• TIGR01229: arginase
  • amino acids 8 to 301 (294 residues), 317.7 bits, E=3.9e-99

Best Hits

Swiss-Prot: 68% identical to ARGI_BRUSU: Arginase (arcB) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K01476, arginase [EC: 3.5.3.1] (inferred from 70% identity to met:M446_1825)

MetaCyc: 60% identical to arginase subunit (Agrobacterium tumefaciens)
Arginase. [EC: 3.5.3.1]

Predicted SEED Role

"Arginase (EC 3.5.3.1)" in subsystem Arginine and Ornithine Degradation (EC 3.5.3.1)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (15/17 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-arginine degradation VI (arginase 2 pathway) (4/4 steps found)
• superpathway of putrescine biosynthesis (4/4 steps found)
• L-arginine degradation I (arginase pathway) (3/3 steps found)
• L-arginine degradation VII (arginase 3 pathway) (2/2 steps found)
• putrescine biosynthesis III (2/2 steps found)
• urea cycle (4/5 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• superpathway of polyamine biosynthesis I (6/8 steps found)
• L-N^δ-acetylornithine biosynthesis (5/7 steps found)
• L-canavanine degradation I (1/2 steps found)
• superpathway of polyamine biosynthesis II (4/8 steps found)
• superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (4/16 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.1

Protein Sequence (309 amino acids)

>ABIE41_RS02350 arginase (Bosea sp. OAE506)
MDRTNCILLGAPVQDGTGRLGCDMGPSAFRAAGIGEALRSLGHGVVDRGNVAPAPLQSLS
HPNPAIHALPEVVAWTQALSQAIYEAGAEGMPIVLGGDHSLAAGTLAGHARRAQESGRKL
FVLWLDAHPDVHTLESTESGHLHGVPMAYALGLPGFAGVFPPLTATLDPARICMMGLRSV
DPAERQVLAAMGLRVHDMRAIDEEGVAPLLRGFLDEVAAQDGLLHVSLDVDFLDPDIAPG
VGTTVLGGATFREAHLIMEMLHDSGRVASLDLVELNPFLDERGRTARLMVDLAASLMGRR
VLDRPTRSF