Protein Info for ABIE41_RS00080 in Bosea sp. OAE506

Annotation: EF-P lysine aminoacylase EpmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF00152: tRNA-synt_2" amino acids 20 to 345 (326 residues), 143.7 bits, see alignment E=3.8e-46 TIGR00462: EF-P lysine aminoacylase GenX" amino acids 22 to 343 (322 residues), 379 bits, see alignment E=9.7e-118

Best Hits

KEGG orthology group: K04568, lysyl-tRNA synthetase, class II [EC: 6.1.1.6] (inferred from 73% identity to met:M446_0378)

Predicted SEED Role

"Translation elongation factor P Lys34:lysine transferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.6

Use Curated BLAST to search for 6.1.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>ABIE41_RS00080 EF-P lysine aminoacylase EpmA (Bosea sp. OAE506)
MTNALPPFWRPDIHADRRPALLARGRIRAALRRWFEARDFVEVEAAILQVSPGNETHLHG
FATTLIDDAGARHPYYLHTSPEFAAKKLLAAGEPRIFDFARVFRNRERTALHHPEFTMLE
WYRAGEGYETLMGDCADMLAAAARAAGVTTLRWRGSEADPFAQPERLTLQEAFQRHAGID
LLRTVTADNDVDRGGLAADAAEAGIRVAEDDSWSDIFSRILSERIEPHLGRGRATILCEY
PISEAALARPKPGDPRVSERFELYACGVELANAFGELTDPAEQRRRFEADMAEKARIYGE
RYPVDEDFLSALAAMPQASGIALGFDRLVMLCTGARRIEDVLWTPVAEPGRGAA