Protein Info for ABIE40_RS29755 in Rhizobium sp. OAE497

Annotation: Ku protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02772: Ku protein
  • amino acids 6 to 261 (256 residues), 285.2 bits, E=2.6e-89
• PF02735: Ku
  • amino acids 12 to 175 (164 residues), 144.5 bits, E=1.9e-46

Best Hits

Swiss-Prot: 71% identical to KU_AGRVS: Non-homologous end joining protein Ku (ku) from Agrobacterium vitis (strain S4 / ATCC BAA-846)

KEGG orthology group: K10979, DNA end-binding protein Ku (inferred from 86% identity to rlt:Rleg2_5141)

Predicted SEED Role

"Ku domain protein" in subsystem DNA Repair Base Excision

Protein Sequence (269 amino acids)

>ABIE40_RS29755 Ku protein (Rhizobium sp. OAE497)
MAPFRWKGYLKLSLVTCPVSMTSATSESEKVRFHTLNKSTGNRVVSQYVDSVTGKPVKDE
NEAKGYARGENDYVILTDDDLDRVTLDTVKTIDIEKFVPAESIEWVYLEKPNYLMPDDPV
GNEAFAVIRDAMKSDGVVGLSKLVMGRRERAVILEPRGEGIVLWSLRFGDEVRPEENYFD
DIEDEGDPDLVPLVQKLIKQQTSHWSPDMVSDPIQESLLKLIEEKKKALRPKKSAKGKTS
EASPKSNVVNIMDALKKSVAEELKSRKAG