Protein Info for ABIE40_RS25940 in Rhizobium sp. OAE497

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 75 to 101 (27 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 94 to 272 (179 residues), 56.4 bits, see alignment E=1.7e-19

Best Hits

Swiss-Prot: 32% identical to YOR2_CALSR: Putative ABC transporter permease protein ORF2 from Caldicellulosiruptor sp. (strain Rt8B.4)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 90% identity to ret:RHE_CH02055)

MetaCyc: 30% identical to ABC-type sulfoquinovose transporter permease subunit (Clostridium sp. MSTE9)
7.5.2.-

Predicted SEED Role

"ABC-type sugar transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>ABIE40_RS25940 carbohydrate ABC transporter permease (Rhizobium sp. OAE497)
MTDTTDTIRMPATTKVYLYVSLTLIAALVLVPLLTTALGGFKTLGDLRVNPFGLPATWQW
SNYTDILFGERYWLQIFNSLVIAVLTVSLTLIVSSMAAFTFAHVRFFGSSFLLNYFLLGL
MFPAATAILPLFIRIRDLGLLDTYWGVVLPQVAFGLGMSILLFRNYFRNLPEELFQAAFV
DGCGYMRFFWYISLPLSRPIIATVSIISFVGSWNSYILPLIMLNSESKYPWPLGIMVYRG
EFGTEWQLVLAFITLTIMPTVIVFFLAQRHIIAGLTAGAVKS