Protein Info for ABIE40_RS25895 in Rhizobium sp. OAE497

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 81 to 108 (28 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 172 to 197 (26 residues), see Phobius details amino acids 229 to 252 (24 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 99 to 298 (200 residues), 47.3 bits, see alignment E=1e-16

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 93% identity to rlg:Rleg_4717)

Predicted SEED Role

"putative sugar ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>ABIE40_RS25895 sugar ABC transporter permease (Rhizobium sp. OAE497)
MSPIAIEAASPPHSRSFMRRFAGAPLPWIMPVIIVIGIFYLYPVIDVFRLSFTNATLIGD
NQEYTFGSITNALSSPQLPDIMWATLVFVGGSVVGQQILGIAVAVVVVRGEKRGLFGTTI
LRTTALVAWVVPGIAGGIIWQMLFSEAPYGALNSILRMMHLPVVAWLSDPSIAPWSALIS
NIWRGTAFSMVVMYAALKAIDPSLYEAAEVDGATGTQQFFFVTIPQLRAAILVNMILITI
MTLNTFDAIITLTGGGPGRATEVISLYVFNIVFRNYDLSGGSVLSVLMLIISLGLAFVYA
SFLPKEEEQ