Protein Info for ABIE40_RS25810 in Rhizobium sp. OAE497

Annotation: TRAP transporter large permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 25 to 26 (2 residues), see Phobius details amino acids 41 to 67 (27 residues), see Phobius details amino acids 74 to 117 (44 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 165 to 192 (28 residues), see Phobius details amino acids 212 to 268 (57 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details amino acids 353 to 384 (32 residues), see Phobius details amino acids 397 to 422 (26 residues), see Phobius details amino acids 434 to 460 (27 residues), see Phobius details PF06808: DctM" amino acids 5 to 247 (243 residues), 226.4 bits, see alignment E=2.9e-71 amino acids 255 to 456 (202 residues), 221.8 bits, see alignment E=7.4e-70

Best Hits

KEGG orthology group: None (inferred from 95% identity to ret:RHE_PF00070)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>ABIE40_RS25810 TRAP transporter large permease (Rhizobium sp. OAE497)
MLLLLGSFLLLMVIGVPVAISMAVASVLYIVLYGVAPDIIVAQRMIAGVESFPLLAVPFF
ILAGNLMNSAGVTGRIYSFAVALVGWMKGGLAQVNIIGSVIFSGMSGTALADAAGIGTIE
IKAMKDHGYPVEAAVGVTAASATLGPIFPPSLPFVIYGMMANVSIGALFMAGILPGIVMT
LLMMVTVAAFAYRKRWGADAPFDVKQLVSAGMEIVVVLLVPLSIYLMMLAGLSMNAAAGI
ALLVLLGLDWYFGFSAVMALMTPVILIGGMTMGWFTPTEAAVAAVLWSLFLGLVRYRTMT
FSTLAKASFDTIETTASVLFIVTAASVFAWLLTVSQAAQLLSDAILSITDNKWVFLILVN
LLMLFVGCFLDTIAAITILVPILLPIVAKFGIDPVQFGLIMTLNLMIGLLHPPLGMVLFV
LSRVAKLSVERTTIAILPWLVPLFVALILITFVPSISLWLPQQLGLIR