Protein Info for ABIE40_RS25385 in Rhizobium sp. OAE497

Annotation: ectoine/hydroxyectoine ABC transporter permease subunit EhuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 13 to 38 (26 residues), see Phobius details amino acids 46 to 71 (26 residues), see Phobius details amino acids 83 to 100 (18 residues), see Phobius details amino acids 144 to 144 (1 residues), see Phobius details amino acids 147 to 148 (2 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details TIGR03004: ectoine/hydroxyectoine ABC transporter, permease protein EhuC" amino acids 4 to 216 (213 residues), 346.6 bits, see alignment E=6.2e-108 TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 7 to 104 (98 residues), 85.1 bits, see alignment E=3.9e-28 PF00528: BPD_transp_1" amino acids 29 to 210 (182 residues), 66.6 bits, see alignment E=1.2e-22

Best Hits

Swiss-Prot: 51% identical to Y4TF_SINFN: Probable amino-acid ABC transporter permease protein y4tF (NGR_a01530) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 87% identity to atu:Atu4754)

Predicted SEED Role

"amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>ABIE40_RS25385 ectoine/hydroxyectoine ABC transporter permease subunit EhuC (Rhizobium sp. OAE497)
MDWTAYLPMLWHGAFITMTITLASIAVGAVLAFIFGILRVEGGPILSAVALCYTEVFRGT
SLFVQLFWFYYALPLVGLSFDPITTGILVLAAHAGGYGAEIVRGALSSVSVQQLEAARAL
NFSRFQTLFRISLPQAIVEMMPAFGNLAIETLKLSSLVSLISIADLTFAAQSIRNITLDS
ASIYSITLLCYFAMSLVLMVAIRVIEHFVRRGHAFPQMPRS