Protein Info for ABIE40_RS24695 in Rhizobium sp. OAE497

Annotation: dihydroxyacetone kinase subunit DhaK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02363: dihydroxyacetone kinase, DhaK subunit
  • amino acids 3 to 330 (328 residues), 407.2 bits, E=2.3e-126
• PF02733: Dak1
  • amino acids 20 to 330 (311 residues), 422.3 bits, E=4.9e-131

Best Hits

Swiss-Prot: 50% identical to DHAK2_LISIN: PTS-dependent dihydroxyacetone kinase 2, dihydroxyacetone-binding subunit DhaK (dhaK-2) from Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

KEGG orthology group: K05878, dihydroxyacetone kinase, N-terminal domain [EC: 2.7.1.-] (inferred from 78% identity to mci:Mesci_5316)

Predicted SEED Role

"Putative dihydroxyacetone kinase (EC 2.7.1.29), dihydroxyacetone binding subunit" in subsystem Dihydroxyacetone kinases (EC 2.7.1.29)

MetaCyc Pathways

• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• glycerol degradation II (1/2 steps found)
• glycerol degradation to butanol (10/16 steps found)
• superpathway of glycerol degradation to 1,3-propanediol (1/4 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.1.29

Use Curated BLAST to search for 2.7.1.- or 2.7.1.29

Protein Sequence (336 amino acids)

>ABIE40_RS24695 dihydroxyacetone kinase subunit DhaK (Rhizobium sp. OAE497)
MTVKKIINNGADAVDEMLAGILAAHPNHLKRVEGTARSVVAVDGPRQGKVGLVIGGGSGH
EPSFVGFVGRGLADGAAIGNVFASPPPDPVLECAKAVNGGAGVLFMYGNYAGDVMNFDMA
AEMAAMEDIEVRTVLTTDDVASAPRDRRADRRGVAGNVFVFKIAGAAADRMMDIDACEAA
ARKANDRTFTMGVALGPCSLPQTRKPNFELGENEMEIGMGIHGEPGVERGPLKSANEITD
QLLDKILPEMNAARGDRVAVLVNGLGATPLMELYIMMARVKERLDGEGLVIHSTLVGNYC
SSLDMMGASVTLMHLDHELQTLLDHPCDCAMFRSGR