Protein Info for ABIE40_RS24375 in Rhizobium sp. OAE497

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00106: adh_short" amino acids 8 to 195 (188 residues), 186.1 bits, see alignment E=7.7e-59 PF08659: KR" amino acids 12 to 172 (161 residues), 31.4 bits, see alignment E=2.6e-11 PF13561: adh_short_C2" amino acids 14 to 224 (211 residues), 139.9 bits, see alignment E=1.6e-44

Best Hits

Swiss-Prot: 74% identical to RIDH_KLEAE: Ribitol 2-dehydrogenase (rbtD) from Klebsiella aerogenes

KEGG orthology group: K00039, ribitol 2-dehydrogenase [EC: 1.1.1.56] (inferred from 91% identity to rle:pRL90116)

MetaCyc: 74% identical to ribitol dehydrogenase subunit (Klebsiella aerogenes)
Ribitol 2-dehydrogenase. [EC: 1.1.1.56]

Predicted SEED Role

"Ribitol 2-dehydrogenase (EC 1.1.1.56)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.56)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>ABIE40_RS24375 SDR family oxidoreductase (Rhizobium sp. OAE497)
MTGLMKGKVAAITGAASGIGLECARTLHAEGATVVLVDRAKDKLEALCKEIGEGALPLVV
DLLDGKQVSGMLPRILEIAGRLDIFHANAGAYIGGQVAEGDPDAWDRMLNLNINAAFRSV
HAVLPHMIEQKSGDILFTSSIAGMVPVVWEPIYTASKFAVQAFVHSTRRQVAPHGVRVGA
VLPGPVVTALLDDWPKAKLDEALANGSLMQPKEVADAVLFMLSRPRNVTIRDLVILPNSV
DL