Protein Info for ABIE40_RS22420 in Rhizobium sp. OAE497

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 94 to 274 (181 residues), 39.2 bits, see alignment E=3.2e-14

Best Hits

KEGG orthology group: None (inferred from 82% identity to avi:Avi_5510)

Predicted SEED Role

"ABC transporter, membrane spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>ABIE40_RS22420 sugar ABC transporter permease (Rhizobium sp. OAE497)
MSGPSLRTRLAARGLDGTTLLVLPGLIFMIALFVYPFLYGVVDSLTPKDGGAWYANYVKF
FSDPFQYNTIGATMWLALPVTIVNLALAVPIAFRVRLMRRQRLLTTILVLPITLGTVFVA
DGLLTFLGPRGWFNQTLLVLGLLDSPMKLTNNYWGVFASLLITGFPFAFLLTLSYITGID
PAIEQAAATLGASPRQRFFRVFLPLLVPGLAVTFCLAFVQAFAVFPSAVLLGAPAGPTRV
ISIAAYQAAFEQYDHSLGSAIALIMGAVELVVVVAILGCRSFFYRGPAGGTKG