Protein Info for ABIE40_RS21365 in Rhizobium sp. OAE497

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 69 to 95 (27 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 176 to 206 (31 residues), see Phobius details amino acids 240 to 264 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 87 to 259 (173 residues), 59.2 bits, see alignment E=2.3e-20

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 75% identity to vpe:Varpa_4068)

Predicted SEED Role

"Various polyols ABC transporter, permease component 2" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>ABIE40_RS21365 carbohydrate ABC transporter permease (Rhizobium sp. OAE497)
MRKFKFGRLAGQAILALAAFSAVFPVFWTTLNAFKNRVDIVTPTPLFFFTPTLDNFAYVL
GRDSVFAGLVNSLIISGTAVLIGAVLGLPAAYAIARYPNRWSKDIQFFVLSLRFLPPVAV
AIPLMVIWLDFGFYDTRLSMIVTYTLLTLATVVWLSVPAFARVPKEVEEAARVDGYGLFS
IFFLIALPIAARSLIGAVAFSFVLVWNEFLIALMLTTSDAKTLPIVASELTQLGRDVPWG
ILNASVVLLSIPPLLFLGVLSGMLNSAFKRKSS