Protein Info for ABIE40_RS20100 in Rhizobium sp. OAE497

Annotation: phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 53% identity to mlo:mll3631)

MetaCyc: 46% identical to phosphodiesterase subunit (Delftia acidovorans)
3.1.3.-

Predicted SEED Role

"3',5'-cyclic-nucleotide phosphodiesterase (EC 3.1.4.17)" in subsystem cAMP signaling in bacteria (EC 3.1.4.17)

MetaCyc Pathways

diethylphosphate degradation (2/2 steps found)

KEGG Metabolic Maps

Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.17

Use Curated BLAST to search for 3.1.4.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>ABIE40_RS20100 phosphodiesterase (Rhizobium sp. OAE497)
MKLIHISDFHLVPAGGTLLGLDPAARMDACLTDVETHHADADLVVVSGDLSDTGGEDTYR
IIQERISRSELPIRLMLGNHDIRENFATVFPSQMAKNGFAQAAIDMPEGRVITLDTLDDG
KVTGRLCNSRLAWLKEKLEEAKDRPVYLFMHHPADKVHLPALDVFGLLDPEPLFALLKAH
GDVRHIFAGHLHRLVTGNWQGIPFTILRSTNHQTALDFVSPTTTNCFEPPMYSIILADRD
SLIVHIHQFAD