Protein Info for ABIE40_RS19755 in Rhizobium sp. OAE497

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 PF00005: ABC_tran" amino acids 28 to 193 (166 residues), 86.8 bits, see alignment E=9.9e-28 amino acids 336 to 491 (156 residues), 117.9 bits, see alignment E=2.5e-37 PF13304: AAA_21" amino acids 136 to 228 (93 residues), 27.5 bits, see alignment E=1.3e-09 PF08352: oligo_HPY" amino acids 244 to 283 (40 residues), 29.9 bits, see alignment 2.6e-10 amino acids 543 to 583 (41 residues), 26 bits, see alignment 4.3e-09

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 90% identity to rle:pRL110054)

Predicted SEED Role

"ATP-binding component of a ABC transport system (oligopeptide)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (631 amino acids)

>ABIE40_RS19755 ABC transporter ATP-binding protein (Rhizobium sp. OAE497)
MASASDLLRIENLDVSFSVFGDKLRVVRNAGLRILPGKVTALVGESGSGKSVISQSIMGI
LPTPAKATGKILFTDPLDGKTTDILQYGRDSEEMRDLRGKRMATIFQEPMTSLSPLHTVG
NQISESLLIHTDADKKLAREKTEEMLGLVGFANPKRTYDMYPFELSGGMRQRAMIAMALI
CRPALLIADEPTTALDVTIQAQILELLRDLQHKLGMAMLLITHDLGVVANMADEVVVIYH
GEIMEAGPVKEIFRNPQHPYLKGLMAAVPHFDMKPGERLKALRDVPVNLESLIGKKKTVE
ADAPQVLLSVNNLSKTYMTRKRSLFGQGERSVLRAVDDVSFDIKRGECLGLVGESGCGKT
TVSKILMRAITPDTGSVVFNDGKEVIDVLSVKGDALQELRTKIQMVFQDPVSSLSPRMTV
RNILSEPLEIHDRGDSEERKRKVEALMGAIGLDRRYLSRYPHSFSGGQRQRIGIARALAL
GPKLVILDEPVSALDVSVQAQILNLLKDLQKELGLTYLFISHNLAVVDYMADRIAVMCKG
RIVEIAPREIILRDPVHPYTKSLLAAVPFPDLDRPLDFEALRKNGAADKQNWGLTFTAEH
DDASELAYADLGDGHFVRARKGADVKELRAW