Protein Info for ABIE40_RS19650 in Rhizobium sp. OAE497

Annotation: 3-carboxy-cis,cis-muconate cycloisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02426: 3-carboxy-cis,cis-muconate cycloisomerase
  • amino acids 10 to 341 (332 residues), 385.9 bits, E=7.1e-120
• PF00206: Lyase_1
  • amino acids 32 to 287 (256 residues), 95.9 bits, E=1.6e-31

Best Hits

KEGG orthology group: K01857, 3-carboxy-cis,cis-muconate cycloisomerase [EC: 5.5.1.2] (inferred from 71% identity to ara:Arad_9505)

Predicted SEED Role

"3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 5.5.1.2)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (8/9 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• superpathway of aerobic toluene degradation (10/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (12/35 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.2

Protein Sequence (349 amino acids)

>ABIE40_RS19650 3-carboxy-cis,cis-muconate cycloisomerase (Rhizobium sp. OAE497)
MSAIAFDHPFLSGLLGDEETAAYFSGEADIRAMLQFEAALARAQAAHDIIPLAAAETISS
ACASFAPDIGSLRTATARDGVVIPELVRQLRAAAGEAGTQVHIGATSQDVIDTSLMLRLK
PVAFVFAAHLTAIEVRLAELHQTFGSRPLMGRTRMQAAIPITVADRLRAWRNPFDGYREK
LTELRFPLQFGGAAGILEKFGGKAAAVRSSLAQELGLADLPQWQSQRGIIAEFANLLALI
SGSLGKFGQDIALMAQAGDEIALSGGGGSSAMAHKQNPVAAETLVALARFNATQISAIHQ
SMIHEQERSGAAWTLEWLVLPQMAIATGAALRLARELANNINRLGAVNP