Protein Info for ABIE40_RS19045 in Rhizobium sp. OAE497

Annotation: pyridoxal-phosphate dependent enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 49% identical to SDSL_MOUSE: Serine dehydratase-like (Sdsl) from Mus musculus

KEGG orthology group: None (inferred from 84% identity to rle:RL4706)

Predicted SEED Role

"Threonine dehydratase (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis or Threonine degradation (EC 4.3.1.19)

MetaCyc Pathways

superpathway of branched chain amino acid biosynthesis (17/17 steps found)
superpathway of L-isoleucine biosynthesis I (13/13 steps found)
L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
L-methionine degradation II (3/3 steps found)
L-threonine degradation V (1/2 steps found)
superpathway of L-threonine metabolism (12/18 steps found)
L-threonine degradation I (3/6 steps found)
hypoglycin biosynthesis (4/14 steps found)
cyclosporin A biosynthesis (2/15 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.19

Use Curated BLAST to search for 4.3.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>ABIE40_RS19045 pyridoxal-phosphate dependent enzyme (Rhizobium sp. OAE497)
MSPSPLHLNTPLLRSAADYSASGKPLLLKLDALQPSGSFKMRGVSRLCQHEVENGAKEIF
CASGGNAGIAAAFAGRALGVPVTIVVPETTSAEVRQSIEATGASVLVHGSVFDEANAYAI
KLSEARKAAYVHPFDHPLLWEGHGTLIDEVVASGTRFDCVVASVGGGGLLAGIVAGLKRN
GLGDVPVIAVETEGAASFHEALKAKERITLPGITSIANSLGARQVAQHVFDLPNHHPIES
VTVTDAEAVAACLKFADAHRILVEPACGAALAVADVHAGLLSRFENPLIEVCGGIGVSLG
KLKAWQERFF