Protein Info for ABIE40_RS18550 in Rhizobium sp. OAE497

Annotation: lysine-2,3-aminomutase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03822: lysine-2,3-aminomutase-related protein
  • amino acids 7 to 324 (318 residues), 577.5 bits, E=6.5e-178
• TIGR00238: KamA family protein
  • amino acids 8 to 314 (307 residues), 268 bits, E=1e-83
• PF04055: Radical_SAM
  • amino acids 102 to 250 (149 residues), 49 bits, E=8e-17

Best Hits

KEGG orthology group: K01843, lysine 2,3-aminomutase [EC: 5.4.3.2] (inferred from 82% identity to rlg:Rleg_4126)

Predicted SEED Role

"Lysyl-lysine 2,3-aminomutase"

MetaCyc Pathways

• L-lysine fermentation to acetate and butanoate (2/10 steps found)
• superpathway of L-lysine degradation (12/43 steps found)

KEGG Metabolic Maps

• Lysine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.3.2

Protein Sequence (350 amino acids)

>ABIE40_RS18550 lysine-2,3-aminomutase-like protein (Rhizobium sp. OAE497)
MNIVRPIKSVDDLSNAGLIAEGDRLALEEVAARYAIALTPSVAALIDRDDPADPIARQFV
PVGDELRILPEERADPIGDIAHSPVEGIVHRYPDRVLLKAVHVCPVYCRFCFRREMVGPQ
GLGTLEPEAMKAAFDYIRQHDEIWEVILTGGDPLILSPRRLEEIMRELATIDHVKIVRFH
TRVPVVEPRKIDAALVAALKASGKTVYVALHANHPREFTDEARAACARLVDAGIVMISQS
VLLKGVNDDPAVLADLMKRFVENRIKPYYLHHPDLAPGTSHFRLSIEEGQKIVAALRGRI
SGLCQPAYILDIPGGHGKTVISQSGLRKTADGCFSVSDYRGGEHVYPPVV