Protein Info for ABIE40_RS17185 in Rhizobium sp. OAE497

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 32 to 55 (24 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 180 to 205 (26 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 110 to 305 (196 residues), 63.7 bits, see alignment E=9.5e-22

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 93% identity to rec:RHECIAT_CH0003982)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>ABIE40_RS17185 sugar ABC transporter permease (Rhizobium sp. OAE497)
MSTVATTDPVLTSNPSARASIRGRLQDALPKIVLAPSFLITIIFVYGFIVWTAYLSFTNS
KTFPSYDLTGPRAYQRLWRWTFESDPPSSWYTSITNMGIFGFLYIGICLALGLFLAILLD
QKIRGEGILRPIFLYPMALSFIVTGVAWKWFLDPGLGLEQTLHQFGWTSFHFDWIKNKDF
VIYTVVIAGVWQASGFVMAMFLAGLRGIDGEIMKAAQIDGASTLQLYRRIIIPLLRPVFL
SAFIVLAHMAIKSYDLVVALTSGGPGGSAWLPSNFMYEYTFKRNEMAVGSASAIIMLMTI
SAIIVPYLYSELKEKAR