Protein Info for ABIE40_RS17010 in Rhizobium sp. OAE497

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 12 to 19 (8 residues), see Phobius details transmembrane" amino acids 20 to 35 (16 residues), see Phobius details amino acids 68 to 94 (27 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details amino acids 260 to 284 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 106 to 287 (182 residues), 51 bits, see alignment E=7.6e-18

Best Hits

KEGG orthology group: K10228, sorbitol/mannitol transport system permease protein (inferred from 90% identity to rlg:Rleg_3751)

MetaCyc: 61% identical to polyol ABC-type transporter permease component MtlF (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 1" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>ABIE40_RS17010 sugar ABC transporter permease (Rhizobium sp. OAE497)
MATLHTRSAARMMMAPSVILLLLWSLIPLAMTIYFSLLNYNLLSPGMETFVGFLNYKYFL
TDPAFFSALGNTLLLVLGVLLITVIGGIAFAILLNQDIYGQGIVRILVIAPFFVMPTVAA
LVWKNMFMNPVNGLFAHLAKALGLQPYDWLANAPLFSIILIVAWQWLPFATLIMLTALQS
LDEEQQEAAEMDGAGVVSKFIYIVLPHMARAITVVILIQTIFLLSVFAEILVTTNGGPGT
QSTNLTYLVYVQALLQFDIGGASAGGIVAVILANIVAIFLVRLVGKNLEA