Protein Info for ABIE40_RS15945 in Rhizobium sp. OAE497

Annotation: FAD-binding dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01494: FAD_binding_3" amino acids 2 to 41 (40 residues), 23.4 bits, see alignment 1e-08 PF00890: FAD_binding_2" amino acids 4 to 531 (528 residues), 303.7 bits, see alignment E=7.8e-94 PF01134: GIDA" amino acids 4 to 36 (33 residues), 22.6 bits, see alignment (E = 1.6e-08) PF12831: FAD_oxidored" amino acids 4 to 55 (52 residues), 33.1 bits, see alignment 1.3e-11 PF13450: NAD_binding_8" amino acids 7 to 43 (37 residues), 28.1 bits, see alignment 6e-10

Best Hits

Swiss-Prot: 64% identical to Y5835_MYCS2: KsdD-like steroid dehydrogenase MSMEG_5835 (MSMEG_5835) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K07077, (no description) (inferred from 76% identity to rhi:NGR_c28200)

Predicted SEED Role

"Fumarate/succinate/L-aspartate dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (545 amino acids)

>ABIE40_RS15945 FAD-binding dehydrogenase (Rhizobium sp. OAE497)
MECDVLVIGAGLAGLVAAAEAADRGHKVCIVDQEGEQSLGGQAFWSLGGLFFVNSPEQRR
LGIRDNIDLARQDWSGSAGFDRPEDYWPRLWAEAYLEFAAGEKRSWLHQQGMRWFPVVGW
AERGGGMAHGHGNSVPRFHLTWGTGPAVLEPFIRRVRAAGEEGKITFAFRHRVDDLIVEN
GTVVGAFGTVLVPDNAPRGKPTARMISGTFQIRAGAIIVTSGGIGGNHDLVRRNWPQQRL
GPPPASMVAGVPAHVDGRMLEIGERAGARVINGDRMWHYTEGLKNWDPVWANHGIRILPG
PSSFWCDARGNRFAAPAMPGFDTLGTLKAIRQTGYDYSWFILTKAIIKKEFALSGSEQNP
DLTGKDIKLLLQRLGSEPPGPVKAFMDKGEDFIVRNTLEQLVDGMNALTGEGLLDVSHIR
HQIEARDREIENSFSKDAQVTAIRGARSYIGDKLLRTARPHRLLDPAKGPLIAVKLHILT
RKSLGGLETDLSARVIGPDGNAVPGLYAAGEVAGFGGGGMHGYNALEGTFLGGCIFSGRV
AGRAV