Protein Info for ABIE40_RS15415 in Rhizobium sp. OAE497

Annotation: tripartite tricarboxylate transporter TctB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 64 (23 residues), see Phobius details amino acids 74 to 112 (39 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details PF07331: TctB" amino acids 12 to 144 (133 residues), 63.7 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 37% identical to YTZ1_AGRVI: Uncharacterized 16.3 kDa protein in TAR-I ttuC' 3'region from Agrobacterium vitis

KEGG orthology group: None (inferred from 86% identity to rle:RL3890)

Predicted SEED Role

"Tricarboxylate transport protein TctB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>ABIE40_RS15415 tripartite tricarboxylate transporter TctB family protein (Rhizobium sp. OAE497)
MKSVTFDTTNAICGALLVATGAFFAYQSFTLELGTALRMGPGYFPLVLSVVLVILGAIVF
IQALRVEGEPIDPFAWRGMLFILPAPILFGLTVRGLGFAPSLFLAAFVACFASQKMNVFY
ALILSLGLTVFSVAVFSYGLGLPFERFGPWTRF