Protein Info for ABIE40_RS13705 in Rhizobium sp. OAE497

Annotation: acyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 68 (18 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 9 to 315 (307 residues), 102.6 bits, see alignment E=2.3e-33

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>ABIE40_RS13705 acyltransferase family protein (Rhizobium sp. OAE497)
MHQQKTRIEWLDIAKGLSIILVVVYHTLLYLNFHEMAPALYTKISNIMAPIRMPLFFSVS
GFLAASAMRATWPDFFRKKIWTFVWLFGVWSTARWLYFRYVHTNGLVPSEGSDSYQLIEM
WWAPNTGIWFIWALAIFMTVTKLLSSAPRIPVIAIGTILSILTFGGYLPIDLFTHRNVLQ
YFVFFAFGCWYGRLIAETLTERPLPFAAGGFSAFILLLALRSRLQPIEPGLWAFASSIAG
LSWLCGMAVLMSRLKALRDVFSYFGRNTLPVYVTHVMIVAGIAGLIATLVEPSPSIGYLA
APLICVTAITLSLAIKAAADRSGASWLYSPPVRRERAVAAA