Protein Info for ABIE40_RS08250 in Rhizobium sp. OAE497

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 53 (19 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 124 to 140 (17 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details PF00892: EamA" amino acids 7 to 140 (134 residues), 41.6 bits, see alignment E=6.8e-15 amino acids 151 to 278 (128 residues), 56.7 bits, see alignment E=1.6e-19

Best Hits

KEGG orthology group: None (inferred from 86% identity to rlg:Rleg_1608)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>ABIE40_RS08250 DMT family transporter (Rhizobium sp. OAE497)
MKSKTQGYIFVLLALTIFSTQDAISKHLGGLYPPIFVTMIRYWAFALFSILLASKMRGGI
RQTAKTKRPLLQVTRGVLLAVQVVLAITCFAVIGLAHSQAIFAATPIVIALLSMPILGER
VGWRRWTAIGAGLFGVLLILKPEGEFFDLKLLLAIVSCFIFAFYVIATRLVSRDDSSMTS
FFYTGVVGGVTMTLIGPFYWTWMSPGDWGWMALVCMTSISSHYCLIRAYDMLDAAAVQPL
TYLQLVYASILGVTIFGESISLNTVIGSVIVVAAGIFTIWREHVVSRQAAKAH