Protein Info for ABIE40_RS07725 in Rhizobium sp. OAE497

Annotation: 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00186: RNA methyltransferase, TrmH family, group 3
  • amino acids 63 to 289 (227 residues), 165.7 bits, E=6.3e-53
• PF08032: SpoU_sub_bind
  • amino acids 65 to 136 (72 residues), 38 bits, E=1.7e-13
• PF00588: SpoU_methylase
  • amino acids 148 to 288 (141 residues), 120.6 bits, E=6e-39

Best Hits

KEGG orthology group: K03218, RNA methyltransferase, TrmH family [EC: 2.1.1.-] (inferred from 89% identity to ret:RHE_CH01655)

Predicted SEED Role

"23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (296 amino acids)

>ABIE40_RS07725 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB (Rhizobium sp. OAE497)
MSKDNKSGGKPATEKTPRDTHYATLRRQHRDAKRERGEIPTPAPQKRKRGGDDWKPPVLA
PEQVYLYGLHTVRAALDNKERRNIKLSVTQNALVRLEIDPETLGIPVEMVAPHDIDKMLG
PDAIHQGVMLETRPLPVRRLEALKDSPLLLVLDQVTDPHNVGAIMRSAVAFNAGAVITTQ
RHSPTESGVMAKSASGALELIPYIQITNLADAVGELHKLGFVTIGLDSEGPAPLEGTFTG
EKVALVLGSEGKGLRQKTRETVNALARLDMPGAIKSLNVSNAAAIALYAARLYLAK