Protein Info for ABIE40_RS05875 in Rhizobium sp. OAE497

Annotation: lysylphosphatidylglycerol synthase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 43 to 67 (25 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 20 to 290 (271 residues), 55 bits, see alignment E=4.9e-19

Best Hits

KEGG orthology group: None (inferred from 78% identity to rlt:Rleg2_0957)

Predicted SEED Role

"FIG01075715: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>ABIE40_RS05875 lysylphosphatidylglycerol synthase domain-containing protein (Rhizobium sp. OAE497)
MNSPVGASRQSWFARNRMTLLTVVIVAAYALFIEWFWGWSSILAQWVAVGVLPIVIALVL
LTSTYFLRTWRILDYFPRETSGQFRTLFRVTQIHNLLNIMLPFRSGETSFPLLMRTEFGI
PLARGTSALLVMRLLDLHALLAAAGIGLASEAGNGLIAWIIWAAFLVLPVAAFIVRKPLL
RFGFKLAPKKAQGFLAEIENGLPVDGIAFARAWAMTAVNWLVKVLVLAWALSLMGVLPLA
ASFGGALGGELSSVLPVHAPGGVGTYPAGITAGAVAFGASGGKEALAALAQASINAHLLI
IVSALTGTAISLPFGRRRQL