Protein Info for ABIE40_RS05480 in Rhizobium sp. OAE497

Annotation: cyclopropane-fatty-acyl-phospholipid synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 PF02353: CMAS" amino acids 116 to 381 (266 residues), 280.9 bits, see alignment E=3.3e-87 PF13489: Methyltransf_23" amino acids 163 to 282 (120 residues), 38 bits, see alignment E=4.2e-13 PF13847: Methyltransf_31" amino acids 172 to 281 (110 residues), 46.5 bits, see alignment E=1.1e-15 PF13649: Methyltransf_25" amino acids 177 to 273 (97 residues), 51 bits, see alignment E=5.7e-17 PF08241: Methyltransf_11" amino acids 178 to 276 (99 residues), 36.4 bits, see alignment E=2e-12 PF08242: Methyltransf_12" amino acids 178 to 274 (97 residues), 45.7 bits, see alignment E=2.8e-15

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 80% identity to rec:RHECIAT_CH0000982)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>ABIE40_RS05480 cyclopropane-fatty-acyl-phospholipid synthase family protein (Rhizobium sp. OAE497)
MASGFLSIVQKIIRKGNLKLTLANGETHTIGDGSGDFVAVRIADEEAEKLIRRDPTLKLG
EMYMDGRFILEHGNIYDFLAMVKQNTTNEIFDIPMAALLIGRIALQQLKSRLPVNHNKRN
VAHHYDLSERLFELFLDEDWQYSCAYFDPPGISLEEAQVAKKRHIAAKMLLEPNQRVLEI
GSGWGGMGLYIAEATPGLDHTGITLSEEQLKISRDRAEKRGIADRVRFELQDYRTMKAEP
FDRIVSVGMFEHVGIGNFPGYFKKVHELLADDGVMVLHSIARPKPSFATNAFIEKYIFPQ
GYIPSIGETIPAIEKAGLLVRDVEVLPLHYAYTLRAWRERFVARKAEAVGLYDERFFRMW
EFYLAGSEIGFRWDELFIMQIQITKNQYSTPDNRNYIPAAETRLKEFEAVRPPLEKITF