Protein Info for ABIE40_RS04215 in Rhizobium sp. OAE497

Annotation: sensor domain-containing phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 970 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 195 to 217 (23 residues), see Phobius details amino acids 228 to 251 (24 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 313 to 336 (24 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 375 to 396 (22 residues), see Phobius details PF07695: 7TMR-DISM_7TM" amino acids 194 to 391 (198 residues), 32.5 bits, see alignment E=2.2e-11 PF08447: PAS_3" amino acids 443 to 521 (79 residues), 56.2 bits, see alignment E=8.8e-19 TIGR00229: PAS domain S-box protein" amino acids 456 to 534 (79 residues), 31.1 bits, see alignment E=2.3e-11 PF08448: PAS_4" amino acids 461 to 528 (68 residues), 23.2 bits, see alignment 1.8e-08 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 536 to 698 (163 residues), 103.1 bits, see alignment E=1.3e-33 PF00990: GGDEF" amino acids 538 to 696 (159 residues), 127.9 bits, see alignment E=8e-41 PF00563: EAL" amino acids 717 to 950 (234 residues), 234.4 bits, see alignment E=3.1e-73

Best Hits

KEGG orthology group: None (inferred from 94% identity to rlg:Rleg_0689)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (970 amino acids)

>ABIE40_RS04215 sensor domain-containing phosphodiesterase (Rhizobium sp. OAE497)
MTTNRMLHLSPSGRLIAVIAAFFLSVLALAAGTAHAAEPVKISRDDTALDLTKTTEIYAN
QGEAFQVSTAAGADGIRRRIEVRASSDNHQGDWAVFALANVSEEQLERVIVAPHFRLVNS
KLFWPDLGSQRIMAITPSEGFALDRQPSDEADVFRITLNPGAVITFVAELTSPDLPQIYL
WEPDAYKDTINAFTLYRGIVLGIAGLLAVFLTILFVVKGTSMLPATAALAWAVLGYICVD
FGFLGKLISIASADQRIWRACAEVALASSFVIFLFTYLNLNRWHTHLGYATLAWVLGLAL
LFGVAIYDPSIAAGIARLSFALTATMGLVLIVYLGLNRYDRAILLVPAWALILVWIFGAW
LTITGRLDNDIIQPALGGGLVLIVLLIGFTVMQHAFAGGAFQQGLFSDLERQSLALTGSG
DMVWDWDVARDRVVTIPDVSVKLGLSPGTMHGAARNWLPRLHPDDRDRFRATLDVLLEHR
RGRLNHEFRIRAEDGHFHWLLIRARPVLGSNGEIIRCVGTIVDVTEQKNSVERLLHDALH
DNLTGLPNRQLFLDRLQSVLALAPSGETLRPTVMVIDIDRYKLVNDALGVAAGDNILIAL
TRRLRRLLKQQDTLARLAGDQFGLILVSERDPAKIADFADAISKAIMVPINFSNREIILT
ASIGLASWVDQQENASGMLSDAELAMYRAKRAGGNRVEPFRPAFRDFGADRLQLESDLRR
AIERKELSMVYQPIAGLENVEIAGFEALMRWEHPKRGNIPPSEFIPIAEASDIIGPLGLF
ALEQATNDLMGWQNQTGELPIFVSINLSSVQLLNNELYDDVRSVLAKTHCEPSRLKLELT
ESMVMENPEQARLVLQKLKEAGLGLALDDFGTGYSSLSYLTRFPFDTIKLDKALVRDDSD
KKATILRSVINMARELDMKVVAEGIESNEDAIELAKMGCSYGQSYLFGPPMPSESVLRLL
KERFPLTKRA