Protein Info for ABIE40_RS03525 in Rhizobium sp. OAE497

Annotation: inorganic phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details amino acids 348 to 366 (19 residues), see Phobius details amino acids 386 to 404 (19 residues), see Phobius details amino acids 410 to 427 (18 residues), see Phobius details amino acids 469 to 494 (26 residues), see Phobius details PF01384: PHO4" amino acids 78 to 487 (410 residues), 355.8 bits, see alignment E=1.1e-110

Best Hits

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 81% identity to rle:RL0857)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (499 amino acids)

>ABIE40_RS03525 inorganic phosphate transporter (Rhizobium sp. OAE497)
MAEKTPVLTKRTLDKDLDKYSHVEDASKFVARKLIAPGIGLVFLGLAMLFAGVYVFDRPG
AVLVIAAAALAAYMAMNIGANDVTNNVGAAVGARAMTMAQALVIAAIFEVLGATIAGGEV
VKTISSSIVDAVSVPEGLLAWIMMAALMAAALWINLATWLNAPVSTTHAIVGAVIGAGIA
AVGPEPVNWRVMVEISSSWVTSPLIGGIIAAGLLFLVKTFVIYRDDKIAAARRWVPVLIA
IMTGGFTAYMILQLTTPDRFPAVTVLAYGLAATVVSWLVARPIVRRQAEGLENRNSSLRI
LFKYPLIGSAALLSFAHGANDVSNAVGPLSAIVRSTTVLPVHGDVAPPLWVMLIGAFGIS
IGLLLFGPRLIRLVGEQITKLNPMRAYCVALSTAFTVIVASWFGLPVSTTHIAVGSVFGV
GFFREWYTRNSKRRIAYMRHKAESWAIDEPVDPNVHETRRRYLVRRSHFMTIIAAWVITV
PASGALAALLYWVMFALFV