Protein Info for ABIE40_RS03015 in Rhizobium sp. OAE497

Annotation: flagellar type III secretion system pore protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 63 (28 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 186 to 211 (26 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details TIGR01103: flagellar biosynthetic protein FliP" amino acids 46 to 244 (199 residues), 312.2 bits, see alignment E=7.2e-98 PF00813: FliP" amino acids 46 to 240 (195 residues), 254.1 bits, see alignment E=5e-80

Best Hits

Swiss-Prot: 82% identical to FLIP_AGRFC: Flagellar biosynthetic protein FliP (fliP) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 92% identity to rlt:Rleg2_0326)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>ABIE40_RS03015 flagellar type III secretion system pore protein FliP (Rhizobium sp. OAE497)
MIRFIIFLAAMMAVPELAVAQQLPTNLLNIPVDGSVAAWIIRTFGLLTVLSVAPGILIMV
TSFPRFIIAFSILRTGLGLSSTPSNMILLSLSLFMTFYVMTPTFDKAWQDGVQPLLSNQI
QEQEAIQRIAEPFRTFMAANTRDKDLALFVDLARERGQNVQTGAQIDYRVLIPAFMISEI
RRGFEIGFLVVLPFLVIDLIVATITMAMGMMMLPPTSISLPFKILFFVLIDGWNLLVGSL
VRSFS