Protein Info for ABIE40_RS00555 in Rhizobium sp. OAE497

Annotation: alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase PhnJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06007: PhnJ
  • amino acids 6 to 277 (272 residues), 486.3 bits, E=1e-150

Best Hits

Swiss-Prot: 89% identical to PHNJ_RHIME: Alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase (phnJ) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06163, PhnJ protein (inferred from 96% identity to rle:RL0174)

MetaCyc: 89% identical to alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase (Sinorhizobium meliloti 1021)
RXN-17959 [EC: 4.7.1.1]

Predicted SEED Role

"PhnJ protein" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

• glyphosate degradation III (7/7 steps found)
• methylphosphonate degradation I (2/5 steps found)
• (aminomethyl)phosphonate degradation (4/8 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.7.1.1

Protein Sequence (292 amino acids)

>ABIE40_RS00555 alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase PhnJ (Rhizobium sp. OAE497)
MTDLASYNFAYLDEQTKRMIRRAILKAIAIPGYQVPFASREMPMPYGWGTGGVQVTASII
GPDDVLKVIDQGADDTTNAVSIRAFFQKVANVAVTTHTKDATIIQTRHRIPEEKLGTNQV
LVYQVPIPEPLRFLEPRETETRKMHALEEYGLMHVKLYEDIAHNGRISKTYAYPVKVAGR
YVMDPSPTPKFDNPKMHMSDALQLFGAGREKRIYAVPPYTEVVSLDFEDYPFEIQRFGKP
CALCGAEEVYLDEVILDDKGGRMFVCSDTDHCEDRREHGHAGEMLAPKEAAE