Protein Info for ABID97_RS29295 in Variovorax sp. OAS795

Annotation: extracellular solute-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 743 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 84 to 204 (121 residues), 51.3 bits, see alignment E=1.8e-17 PF01547: SBP_bac_1" amino acids 336 to 635 (300 residues), 119 bits, see alignment E=6.6e-38 PF13416: SBP_bac_8" amino acids 340 to 652 (313 residues), 90.4 bits, see alignment E=2.7e-29

Best Hits

Predicted SEED Role

"sugar ABC transporter, permease protein (y4oR)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (743 amino acids)

>ABID97_RS29295 extracellular solute-binding protein (Variovorax sp. OAS795)
MKRSPLVTVLHYAMLVALAALCIAPIAVIFTTSLRQQVQIFAEPLNFIFTPTLENYRAVL
QEDKFSSYLMNSLFVGIVSTAVTLVLGCMAAYGLARFRFAGRNTIAYTTLLLRTVPLAVL
AIPVFMIWSQWHLINSLWGLVLLYVAVNLPFTIWLLYGFVLQVPVELEEAAAIDGCGPIQ
VFVKVLLPLMAPGLAAASIFTFRIAVERVHPGAGADRPAHAHAAGGGLAVHHRHGRGLGQ
GDGNGQPHRDPAADLHLRRCAPDHHRAHRRGGQGMMTMPTNPTFIGRRQLIQAAGAYGAA
CWGLGAHAQGAGQAAWGKLRGQTIRVSYPGPHPHYDAAEKLFDDFTRETGIRIERDRTPY
LDMKDRQLAGMRKPQGDHDVITYLVVWKAEYIKEKLLRPLDDMLADPLLAMPGYEFSDLI
PAYVQAIGRANGPKPNLAAPDTRLYGLPCGAETSVLGFRRDILERQKLHVPATYDELLHA
CEVIRDKEKIGGVTSRSQAGHQVTHAWLLHLSPFGGQVFDAGFRPVLHEEPGIKAAETLR
RLVETGPAGAGNAGFDEMQAAFLDGECAFYLDSLAVMGPAKDPRRSKVADKIAYAMHPSA
RRMSGQTGGFGLAIPKNARRPEAACAFIQWMTSKASDLRVATLGGNTGRWSTLANVDFKI
RNPEQGILPFVLRAANPDWRPQIPEWDEMSKNIIGQALPDVLAGRRTAREALASTVAPLA
SLLRSGGWTSAERTRDCCERPTA